PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525244.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 718aa    MW: 78094.8 Da    PI: 6.632
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525244.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   Wk+I +++g  +t+ q++s+ qk+
   XP_010525244.1 24 RERWTEEEHNRFLEALKLYGRA-WKKIEEHVG-SKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.07E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.9971973IPR017930Myb domain
TIGRFAMsTIGR015571.8E-172271IPR006447Myb domain, plants
SMARTSM007172.9E-132371IPR001005SANT/Myb domain
PfamPF002491.7E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-92464IPR009057Homeodomain-like
CDDcd001675.62E-102669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
METNSSGEEL VIKTRKPYTI TKERERWTEE EHNRFLEALK LYGRAWKKIE EHVGSKTAVQ  60
IRSHAQKFFS KVEKEAQAKG FPLGQALDVD IPPPRPKKKP SNPYPRKTGN GNPSQSAAKD  120
EKLPTSTSAL NCIEALVSEN GSLSEMPNEE RQPSNPEENR EDGCSECFTH SRSAYSMNKS  180
SVETTALVNG CTFREFLPLR KEASQDNGKI KASNSENYCD AHTKSVQGSV KNNVHGISHI  240
DDQGPQTYPR HVHTHGLDRS SLTCSMSPFP TVPDEIHGYP NMFVDPSASA TRSEHENDSP  300
RSTPRASPAF HPADAPTPNA PDNYRPFANL ILSTLLQNPA VHAAATFAAS VWPHNPGGPS  360
TCAEGGFPAG QVYSPPSLAA IAVPAATVAA ATAWWAAHGL LPLCGPFHSA FPCHPPPTNV  420
APSDDNGQIP LARVNPKENT LQKPSLQSRE EGPENFEASK AQFSPAKAVS SPSYSEDSER  480
RKTETGTKPG SNEQHAAETD QNGDKNTKQV VDRSSCGSNT SSSSDVEADA SEKLEKGNDE  540
VKEADADPNP PAAESNTRRS RSTNNLTDPW KSVSNEGRLA FQALFSRAVL PQSFSPPHDA  600
KKKKNRTENK DEETKKNTER ENGETLALDL NSKARAADSD HQEEEKGDGL GSGRENTDQK  660
GFLGIGLGTS KLKGRTGFKP YKRCSVEAKD NTIIDTTSLN QAEQKDSKRI RLESEAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00103PBMTransfer from AT2G46830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525244.10.0PREDICTED: protein CCA1
SwissprotP929731e-167CCA1_ARATH; Protein CCA1
TrEMBLA0A061DT310.0A0A061DT31_THECC; Homeodomain-like superfamily protein isoform 1
STRINGVIT_15s0048g02410.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-137circadian clock associated 1